Recombinant Proteins
- (2)
- (970)
- (1)
- (23,544)
- (5)
- (1)
- (1)
- (67)
- (220)
- (4,416)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,464)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,718)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,220)
- (265)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,924)
- (1,408)
- (3)
- (4)
- (5)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (137)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (82)
- (12)
- (2)
- (3)
- (86)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (199)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,726)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (26,017)
- (237)
- (1)
- (3)
- (286)
- (2)
- (62,013)
- (1)
- (15)
- (1)
- (2)
- (45,312)
- (5,865)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (560)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,139)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,026)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,575)
- (1)
- (50)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (46)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (39,212)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Human TDG His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
R&D Systems™ Recombinant Human Fas/TNFRSF6/CD95 (HEK-expr) Fc Chimera
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human Alcohol Dehydrogenase 1C Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Conjugate | Unconjugated |
|---|---|
| Molecular Weight (g/mol) | 40.6kDa |
| Gene Symbol | ADH1C |
| Endotoxin Concentration | <1.0 EU per 1μg of protein (determined by LAL method) |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Baculovirus |
| Name | Human alcohol dehydrogenase 1C Protein |
| Regulatory Status | RUO |
| Purification Method | >95%, by PAGE |
| Gene Alias | ADH, gamma subunit, ADH3alcohol dehydrogenase 1C, alcohol dehydrogenase 1C (class I), gamma polypeptide, alcohol dehydrogenase 3 (class I), gamma polypeptide, Alcohol dehydrogenase subunit gamma, aldehyde reductase, EC 1.1.1, EC 1.1.1.1 |
| Product Type | Recombinant Protein |
| Gene ID (Entrez) | 126 |
| Formulation | Phosphate Buffered Saline (pH 7.4) containing 10% glycerol |
| Immunogen | MSTAGKVIKC KAAVLWELKK PFSIEEVEVA PPKAHEVRIK MVAAGICRSD EHVVSGNLVT PLPVILGHEA AGIVESVGEG VTTVKPGDKV IPLFTPQCGK CRICKNPESN YCLKNDLGNP RGTLQDGTRR FTCSGKPIHH FVGVSTFSQY TVVDENAVAK IDAASPLEKV CLIGCGFSTG YGSAVKVAKV TPGSTCAVFG LGGVGLSVVM GCKAAGAARI IAVDINKDKF AKAKELGATE CINPQDYKKP IQEVLKEMTD GGVDFSFEVI GRLDTMMASL LCCHEACGTS VIVGVPPDSQ NLSINPMLLL TGRTWKGAIF GGFKSKESVP KLVADFMAKK FSLDALITNI LPFEKINEGF DLLRSGKSIR TVLTFHHHHH H |
| Cross Reactivity | Human |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Human Flt-3 Ligand/FLT3L Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Purity or Quality Grade | >97%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie™ Blue Staining. |
|---|---|
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 18 kDa |
| Gene Symbol | FLT3LG |
| Endotoxin Concentration | <0.10 EU per 1 μg of the protein by the LAL method. |
| Storage Requirements | Manual defrost freezer; Avoid repeated freeze-thaw cycles; 12 mo. from receipt, -20 to -70°C as supplied; 1 mo, 2 to 8°C under sterile conditions after reconstitution; 3 mo, -20 to -70°C under sterile conditions after reconstitution |
| For Use With (Application) | Bioactivity |
| Source | Mouse myeloma cell line,NS0-derived human Flt-3 Ligand/FLT3L protein Thr27-Pro185 |
| Accession Number | AAA17999 |
| Regulatory Status | RUO |
| Gene Alias | FL, FLG3L, Flt3 ligand, Flt3L, FLT3LG, fms-related tyrosine kinase 3 ligand, SL cytokine |
| Gene ID (Entrez) | 2323 |
| Formulation | Lyophilized from a 0.2 μm filtered solution in Acetonitrile and TFA with BSA as a carrier protein. |
| Reconstitution | Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin. |
| Cross Reactivity | Flt-3 Ligand |
| Species | Human |
Novus Biologicals™ Firefly Luciferase Recombinant Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95% by PAGE |
| Conjugate | Unconjugated |
| Gene Alias | ec 1.13.12.7, Fluc |
| Product Type | Recombinant Protein |
| Molecular Weight (g/mol) | 38.5 kDa |
| Formulation | 20mM Tris-HCl (pH8.0) containing 1mM DTT, 10% glycerol |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Cross Reactivity | Firefly |
| For Use With (Application) | Bioactivity |
| Source | E.coli |
| Recombinant | Recombinant |
| Name | Firefly Luciferase Recombinant Protein |
R&D Systems™ Recombinant Human Pentraxin 2/SAP His-tag Protein
The Recombinant Human Pentraxin 2/SAP His-tag Protein is derived from NS0
Novus Biologicals™ Calcyphosine Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >95% |
| Conjugate | Unconjugated |
| Common Name | Calcyphosine |
| Molecular Weight (g/mol) | 23.1kDa |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 100mM NaCl |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
R&D Systems™ Recombinant Rat C-Reactive Protein/CRP Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human Synaptotagmin 3 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | DKFZp761O132, synaptotagmin IIISytIII, synaptotagmin-3 |
| Common Name | Synaptotagmin |
| Molecular Weight (g/mol) | TMW: 57.7kDa |
| Gene ID (Entrez) | 84258 |
| Formulation | 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.4M UREA |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human FBXO2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | FBG1, F-box gene 1, F-box only protein 2, F-box protein 2, Fbs1, FBX2Fbg1, Nfb42, OCP1, organ of Corti protein 1 |
| Common Name | FBXO2 |
| Molecular Weight (g/mol) | TMW: 35.7kDa |
| Gene ID (Entrez) | 26232 |
| Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 30% glycerol, 1mM DTT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.25mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
Novus Biologicals™ RABIF/MSS4 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >85% |
| Conjugate | Unconjugated |
| Common Name | RABIF/MSS4 |
| Molecular Weight (g/mol) | 16.0kDa |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT. |
| Immunogen | RABIF, 1-123 aa. MGSSHHHHHHSSGLVPRGSHMEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Human Reelin Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Human GPR158 His-tag Protein
Measured by its binding ability in a functional ELISA.
Gibco™ Human IL-17A Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Protein Family | Cytokines & Receptors |
|---|---|
| Purity or Quality Grade | >95% by SDS-PAGE |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Common Name | IL-17A |
| Molecular Weight (g/mol) | 15.5 kDa |
| Endotoxin Level | <0.1 ng/μg |
| Activity | ED50 = 0.5 - 5.0 ng/mL; determined by the dose-dependent production of GRO-alpha by HT-29 cells. |
| Endotoxin Concentration | <0.1 ng/μg |
| Expression System | E. coli |
| Name | Human IL-17A |
| Purification Method | Purified |
| Gene Alias | Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A |
| Protein Form | Recombinant, Ligand |
| Biological Activity | ED50 = 0.5 - 5.0 ng/mL; determined by the dose-dependent production of GRO-alpha by HT-29 cells. |
| Formulation | Protein with no preservative |
| Classification | Carrier-Free |
| Research Category | Immunology, Neurobiology, Inflammation, Angiogenesis, Signal Transduction |
| Species | Human |
| Recombinant | Recombinant |
| Shipping Condition | Approved for shipment on Wet or Dry Ice |
| Content And Storage | -20°C |
| Gene Symbol | IL17A |
| Sequence | Human IL-17A recombinant protein is homodimeric containing two 137 amino acid subunits |
| Storage Requirements | -20°C |
| Protein Subtype | Interleukins |
| Accession Number | Q16552 |
| Regulatory Status | RUO |
| Product Type | Protein |
| Gene ID (Entrez) | 3605 |
| Product Line | Gibco |